PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37575.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 320aa    MW: 36191.4 Da    PI: 7.4312
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37575.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
       KFK37575.1 14 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.72.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
       KFK37575.1  67 RGKFTVQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.629961IPR017930Myb domain
SuperFamilySSF466894.49E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002496.1E-171461IPR001005SANT/Myb domain
CDDcd001672.22E-111661No hitNo description
PROSITE profilePS5129426.75362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2765117IPR009057Homeodomain-like
SMARTSM007172.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1667112IPR001005SANT/Myb domain
CDDcd001671.17E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVRSPCCDKA GLKKGPWTPE EDQKLLAYIE EHGHGSWRSL PEKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF TVQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKHKN ETLSSSSGQS KNAATLSHMA QWESARLEAE ARLARESKLL HLQHYQNNNN  180
INNNKSNFTH KTWTKPNGDL ESPTSTVTFS ENHPLMTMPL GIPTENRTPA MIDFAVSSST  240
SSDVTLVKEH DHDWMRQINC PTEEIEEGFT SLLLGDTTAG KNDGSGVSVA GAESDYSYYE  300
DNKNYWNSIL NLVDSSPSDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493090.0AF249309.1 Arabidopsis thaliana putative transcription factor (MYB106) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296712.10.0hypothetical protein CARUB_v10013887mg
TrEMBLA0A087H6230.0A0A087H623_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.3__117__AT3G01140.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.11e-162myb domain protein 106